BEGIN:VCALENDAR VERSION:2.0 PRODID:-//Bacon Free Library - ECPv6.15.20//NONSGML v1.0//EN CALSCALE:GREGORIAN METHOD:PUBLISH X-ORIGINAL-URL:https://baconfreelibrary.org X-WR-CALDESC:Events for Bacon Free Library REFRESH-INTERVAL;VALUE=DURATION:PT1H X-Robots-Tag:noindex X-PUBLISHED-TTL:PT1H BEGIN:VTIMEZONE TZID:America/New_York BEGIN:DAYLIGHT TZOFFSETFROM:-0500 TZOFFSETTO:-0400 TZNAME:EDT DTSTART:20230312T070000 END:DAYLIGHT BEGIN:STANDARD TZOFFSETFROM:-0400 TZOFFSETTO:-0500 TZNAME:EST DTSTART:20231105T060000 END:STANDARD BEGIN:DAYLIGHT TZOFFSETFROM:-0500 TZOFFSETTO:-0400 TZNAME:EDT DTSTART:20240310T070000 END:DAYLIGHT BEGIN:STANDARD TZOFFSETFROM:-0400 TZOFFSETTO:-0500 TZNAME:EST DTSTART:20241103T060000 END:STANDARD BEGIN:DAYLIGHT TZOFFSETFROM:-0500 TZOFFSETTO:-0400 TZNAME:EDT DTSTART:20250309T070000 END:DAYLIGHT BEGIN:STANDARD TZOFFSETFROM:-0400 TZOFFSETTO:-0500 TZNAME:EST DTSTART:20251102T060000 END:STANDARD BEGIN:DAYLIGHT TZOFFSETFROM:-0500 TZOFFSETTO:-0400 TZNAME:EDT DTSTART:20260308T070000 END:DAYLIGHT BEGIN:STANDARD TZOFFSETFROM:-0400 TZOFFSETTO:-0500 TZNAME:EST DTSTART:20261101T060000 END:STANDARD BEGIN:DAYLIGHT TZOFFSETFROM:-0500 TZOFFSETTO:-0400 TZNAME:EDT DTSTART:20270314T070000 END:DAYLIGHT BEGIN:STANDARD TZOFFSETFROM:-0400 TZOFFSETTO:-0500 TZNAME:EST DTSTART:20271107T060000 END:STANDARD END:VTIMEZONE BEGIN:VEVENT DTSTART;TZID=America/New_York:20240430T170000 DTEND;TZID=America/New_York:20240430T183000 DTSTAMP:20260429T185120 CREATED:20240301T192949Z LAST-MODIFIED:20240301T192949Z UID:48219-1714496400-1714501800@baconfreelibrary.org SUMMARY:Rebecca McGee Tuck - Meet the Artist Event DESCRIPTION:The Bacon Free Library is hosting a meet the artist event with sculptor and social activist\, Rebecca McGee Tuck.  Come join us on Tuesday\, April 30th from 5-6:30pm. \nRebecca McGee Tuck is a sculptor and an ocean activist.  Her work is a visual narrative of what she accumulates from a throw away society and as a result she gives new life to what others discard. Tuck has shown her work in multiple juried shows throughout the Northeast including the Danforth and Fitchburg Art Museums\, Viridian Arts Gallery\,  NYC\, and the George Marshall Store Gallery in York\, Maine.   Her series of work called  “Along the Wrack Line” deals with the overwhelming amount of debris and plastic trash that contaminate our local New England beaches.  Tuck works among her menagerie of debris from her studio at the Mill Contemporary Art Studios in Framingham. \nWrack Line–  A trail of debris left on the beach by the high tide. \nI began walking the wrack line as a kid with my father—attracted to the sea glass and shells like a perpetual seaside treasure hunt.  I learned in time that the real treasures were not always as conspicuous.  The random debris that washed ashore after spending ages enduring the ocean’s churn and grasp held more mystery for me.  Foraging at the high tide water mark has metamorphosed into my passion and catalyst for my work.  \nFishing lines\, rope\, lobster cages and other marine debris are colorful\, full of texture and ready-made to be woven into my assemblage fiber sculpture.  But with each bag of jetsam collected\, I felt the precarious weight of the impact of marine debris on our ocean.  It has overwhelmed me and it became clear that I needed to take a more active role in the ocean’s protection.  \n“Along the Wrack-line” is the title I have given to my ongoing series of sculpture.  With this work I raise awareness to the constant misuse of the ocean’s ecosystem by transforming pieces of marine debris into works of art and symbols of hope calling attention to the consequences of polluting our oceans and encouraging a new commitment to action! \nInstagram: @Rebeccabombshellart /https://www.instagram.com/rebeccabombshellart/ \nFacebook: RebeccaMcGeeTuckArt https://www.facebook.com/rebeccamcgeetuckart/ \nwebsite: Rebeccamcgeetuck.com https://rebeccamcgeetuck.com/ URL:https://baconfreelibrary.org/event/rebeccamcgeetuck/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/jpeg:https://baconfreelibrary.org/wp-content/uploads/2024/03/HeadShot_2022-e1712075436452.jpg GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20240521 DTEND;VALUE=DATE:20240604 DTSTAMP:20260429T185120 CREATED:20240501T171307Z LAST-MODIFIED:20240520T175946Z UID:48786-1716249600-1717459199@baconfreelibrary.org SUMMARY:Great Blue Herons: A Study of Patience and Grace by Babsje DESCRIPTION:“Alas\, my days of photographing the magnificent Great Blue Herons from the cockpit of my kayak floating on the lake have come to an end.” Posted by Babsje on December 20\, 2023\, shortly before her death in January. babsjeheron.wordpress.com. \nBabsje was a local photographer who focused her lens on the Great Blue Herons in and around Lake Cochituate and on the Charles\, including at the dam in South Natick. She spent many very happy days floating in her kayak\, and the herons became so accustomed to her quiet presence that she was able to beautifully document their private grandeur for all to experience.  \nShe is greatly missed. \n\n \n \n \n\n \n Babsje_HappyBabsje Yoga Heron 3Babsje Yoga Heron 2Great blue heron preening Columbus Day weekend.Babsje great-blue-heron-fishing-near-reedsBabsje Yoga Heron 1 \n\n \n \n \n \n  \nVisit the BFL to enjoy Babsje’s stunning photography collection\, Great Blue Herons: A Study of Patience and Grace. \nPhotographs are available for purchase upon request \nAll proceeds from sales will be donated to Massachusetts Audubon Society \n  URL:https://baconfreelibrary.org/event/herons/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/jpeg:https://baconfreelibrary.org/wp-content/uploads/2024/05/Babsje-Yoga-Heron-1-e1715015816680.jpg GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20240521T170000 DTEND;TZID=America/New_York:20240521T183000 DTSTAMP:20260429T185120 CREATED:20240325T152943Z LAST-MODIFIED:20240325T153315Z UID:48356-1716310800-1716316200@baconfreelibrary.org SUMMARY:Slow Stitching DESCRIPTION:In a busy and chaotic world\, sometimes we just need to slow down\, relax\, and take a few breaths and not worry about creating a product\, but enjoying the process. Slow stitching is a mindful needlework process that focuses on intention and the joy of being in the present moment. Join us to learn about slow stitching. A kit (includes base fabric\, patchwork fabric pieces\, lace\, trims\, buttons\, needle and thread) will be provided\, so please sign up in advance. \nJoin fabric artist\, Helen Bellomo\, to learn how to slow stitch. This program is geared towards all ages. Children under 10 must be accompanied by a caregiver. \nRegistration is required; this workshop is limited to 10 participants. \nThis program is full\, if you would like you may join the waiting list by filling out this form: \n\n\n \n \n Event Waiting List\n \n \n Name(Required)\n \n \n \n First\n \n \n \n \n Last\n \n \n Email(Required)\n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n Δ\n \n \n \n  URL:https://baconfreelibrary.org/event/slowstitching-3/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/jpeg:https://baconfreelibrary.org/wp-content/uploads/2023/10/sewing-needle-541737_640.jpg GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20240604 DTEND;VALUE=DATE:20240627 DTSTAMP:20260429T185120 CREATED:20240604T135000Z LAST-MODIFIED:20240611T164731Z UID:48964-1717459200-1719446399@baconfreelibrary.org SUMMARY:Native American Reflections – We Are Still Here DESCRIPTION:For the month of June\, the BFL is honored to host a multisensory exhibit entitled Native American Reflections – We Are Still Here.  Come to the library to enjoy paintings\, poetry\, baskets\, and other works of art created by members of Natick Nipmuc Tribe\, Abenaki Nation\, Algonquin Nation\, Inuk Nation\, and Wampanoag Nation.  Printing services donated by ICL Imaging. \n \nSeveral of the artists are profiled here \nClick here to learn about the artists of the Natick Nipmuc \n  \n\n \nWhite Feather\nfeatured art work: Waterfalls and Tranquility\n  \n \nWhite Feather is a member of the Wampanoag Nation who lives on traditional Wampanoag homelands with his wife of nearly 50 years and two dogs near old growth pines and two beautiful ponds. Proud of his mixed heritage with Cape Verde\, he walks in a traditional way with the Pipe and Sweat Lodges and honors the Original Instructions to embrace all nations on the Medicine Wheel. His name in language is Wampi-mequim/White Feather. \n  \n  \n \nHear White Feather read his poem The Silent Storm: \nhttps://baconfreelibrary.org/wp-content/uploads/2024/06/The-Silent-Storm-White-Feather.wav\n\n \nBen Mitsuk\nfeatured art work: Fade and Night Sky\n  \n \nBenjamin Mitsuk (they/them) is a Two-Spirit\, Inuk artist based on Ottawa\, Ontario. Their creative practice is heavily informed by their lived experiences as a queer\, trans\, and mixed-race person. When they are not working or creating art\, they enjoy traveling\, spending time in nature/on the land\, and curling up on the couch with a good book.   \n  \n  \n \nHear Ben’s poem Two Worlds: \nhttps://baconfreelibrary.org/wp-content/uploads/2024/06/Two-Worlds-Ben-Mitsuk.wav\n\n \nLinden Limoges\nfeatured art work: Star Girl and Tolba\n  \n \nLinden\, born Linda\, has a mixed heritage including Ukrainian\, Russian\, and Algonquin.  She holds the intentions of Peace\, Gratitude\, Love\, and Kindness with Wonderment for All Beings.  She lives with “her” cat Nibezun and spends much of her time rambling outdoors in the meadows\, the woods\, or by the rivers in Vermont.  \n  \n  \nHear Linden’s poem Dawn Awakening: \nhttps://baconfreelibrary.org/wp-content/uploads/2024/06/Dawn-Awakening-Linden-2.wav\n\n  \nNebi Mstaka\nfeatured art work: Roots and Hawks\n  \n  An enrolled citizen of the Abenaki Nation\, Nebi Mstaka (Water Lily Root) is a painter in watercolors and writer of poetry\, fiction\, and nonfiction. Family\, friends\, and the animal\, plant\, and rock beings are Nebi’s heart. Nebi lives near the Kwenitekw (Long/Connecticut River) and on the lands of the Pocumtuck\, Nipmuc\, and Abenaki people. \n  \n  \n \nHear Nebi read her poem Roots: \nhttps://baconfreelibrary.org/wp-content/uploads/2024/06/Roots-Nebi-Mstaka.wav\n\n \nRoaming Buffalo Wabanaki\nfeatured art work: Wabanaki Light Warrior\n  \n \nCitizen of the Abenaki Nation\, Roaming Buffalo of the Wabanaki is an advocate\, budding indigenous poet\, and artist. Their heart is filled with gratitude and humility to be part of this amazing Painting Poetry Circle and to have this creative and powerful time\, Môwiwi/together. Roaming lives in the cross roads of many amazing traditional homelands including those of their Abenaki\, Pawtucket\, Pennacook\, Agawam\, Massachusett\, Nipmuc\, and Wampanoag relations. \n  \n  \n \nHear Roaming read his poem Without Your Voice: \nhttps://baconfreelibrary.org/wp-content/uploads/2024/06/Without-Your-Voice-There-Is-Only-Silence-Roaming-Buffalo-Wabanaki.wav\n\n  URL:https://baconfreelibrary.org/event/narjune24/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20240608T110000 DTEND;TZID=America/New_York:20240608T123000 DTSTAMP:20260429T185120 CREATED:20240508T165647Z LAST-MODIFIED:20240513T204627Z UID:48820-1717844400-1717849800@baconfreelibrary.org SUMMARY:Native American Reflections - We Are Still Here DESCRIPTION:The Bacon Free Library is hosting an exhibit on Native American Art entitled Native American Reflections – We Are Still Here\, throughout the month of June. Artists include members of the Natick Nipmuc tribe\, Abenaki Nation\, Algonquin\, Inuk  and Wampanoag tribe. Paintings\, poetry\, baskets and other works of art will be on display throughout the month. \n  \nA community gathering where you can meet the artists and hear their stories will take place outside on the grounds of the library on Saturday\, June 8th from 11-12:30pm. The art will be on display from June 4 – June 26th. \n  \n  URL:https://baconfreelibrary.org/event/wearestillhere/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/png:https://baconfreelibrary.org/wp-content/uploads/2024/05/Native-American-Reflections-We-Are-Still-Here5.png GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20240622 DTEND;VALUE=DATE:20240623 DTSTAMP:20260429T185120 CREATED:20240425T195129Z LAST-MODIFIED:20240425T203335Z UID:48694-1719014400-1719100799@baconfreelibrary.org SUMMARY:Closed: the BFL will be closed on Saturdays from June 22 to August 31. DESCRIPTION: URL:https://baconfreelibrary.org/event/closed-for-july-4th-2-2/2024-06-22/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Closings ATTACH;FMTTYPE=image/jpeg:https://baconfreelibrary.org/wp-content/uploads/2024/04/summer-still-life-.jpg GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20240627 DTEND;VALUE=DATE:20240808 DTSTAMP:20260429T185120 CREATED:20240613T140619Z LAST-MODIFIED:20240701T164141Z UID:49126-1719446400-1723075199@baconfreelibrary.org SUMMARY:Marie Picard Craig Art Exhibit DESCRIPTION: \nMarie Craig uses cyanotype photography to explore the overlap between concrete bodies\, or still moments\, and the life instilled in them. Her photographs capture places of formative choice\, incorporating both intention and chance.  \nCyanotype photographs (sometimes called sunprints) are made without a camera by placing objects on paper or fabric that is coated with a solution of iron salts before exposing it in the sun and rinsing with water to produce deep blue images. Marie loves the beautiful blue color of the images\, which she sometimes embellishes with other bright colors or beads. \n  \n\n \n \n \n\n \n _2drFUgS6i8AqUhib7IoNv-XEBKgdU1khC3JdREYLmufmXsjx8_FM2CwYUVMoogP \n\n \n \n \n \n  \nMarie began her career as a medical photographer and illustrator after graduating from Clark University in Worcester with a master’s degree in biology. She later shifted her role to become a teacher\, curator\, photographer\, and gallerist\, all in the fine art community. Marie has shown her work in numerous solo and group exhibitions in the US and Australia. In 2011 she co-founded Fountain Street Gallery in Boston and serves as its director. She lives and works in Natick. \nTo learn more about Marie and her work:  \nhttps://mariecraigart.com/ \nhttps://www.instagram.com/mariecraigphoto \n  URL:https://baconfreelibrary.org/event/mariepicardcraig/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20240716T140000 DTEND;TZID=America/New_York:20240716T150000 DTSTAMP:20260429T185120 CREATED:20240226T220347Z LAST-MODIFIED:20240712T163818Z UID:48149-1721138400-1721142000@baconfreelibrary.org SUMMARY:Hula Hooping with Wildkat Hoops DESCRIPTION:It’s time to put on your dancing shoes and grab those dazzling hoops for an unforgettable workshop of hula hoop magic with Wildkat Hoops. Hooping promotes exercise\, exploration\, expression\, movement\, dance\, and FUN! \nThis intergenerational workshop is open to both kids and adults and is best for ages 5 and up. Hoops are provided. URL:https://baconfreelibrary.org/event/hula-hooping/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured,Kids Special Events ATTACH;FMTTYPE=image/jpeg:https://baconfreelibrary.org/wp-content/uploads/2024/02/unnamed-1.jpg GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20240726T130000 DTEND;TZID=America/New_York:20240726T140000 DTSTAMP:20260429T185120 CREATED:20240628T190648Z LAST-MODIFIED:20240722T162203Z UID:49246-1721998800-1722002400@baconfreelibrary.org SUMMARY:Sun Prints with Marie Craig - NOTE NEW DATE AND TIME DESCRIPTION:DUE TO EXPECTED RAIN\, THIS CLASS HAS BEEN RESCHEDULED TO FRIDAY\, JULY 26TH AT 1:00 PM. \nJoin Marie Craig to learn how to make your own cyanotype (sun print). She will explain what cyanotype (sun printing) is and describe the process. Participants will be asked to collect items from their garden that they can use to make prints of. Prepared paper and black envelopes (to keep prints from being exposed further) will be provided. Participants will arrange their found materials on the paper and place them in the sun for about 10 minutes and take them home to wash with water.  Registration required. Limited to 30 participants. \n\nGeared towards adults and children 7 and up. Please register each person separately to ensure we have enough supplies to go around.\n \n\n \n\n \n \n Sun Prints\n \n \n Name*Email*\n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n Δ URL:https://baconfreelibrary.org/event/sunprints/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:Adult Events,All Ages,Featured ATTACH;FMTTYPE=image/jpeg:https://baconfreelibrary.org/wp-content/uploads/2024/06/x8_FM2Cw-e1719341133685.jpeg GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20240807T100000 DTEND;TZID=America/New_York:20240807T170000 DTSTAMP:20260429T185120 CREATED:20240806T153526Z LAST-MODIFIED:20240806T153912Z UID:49567-1723024800-1723050000@baconfreelibrary.org SUMMARY:Minuteman Library Crawl DESCRIPTION:You’re invited to spend the day visiting Minuteman libraries! \nA “crawl\,” or tour\, is a fun way to visit multiple libraries in your area.  The challenge is to visit as many as you can and take a picture of yourself with a designated item in each library – it’s a 21st century scavenger hunt! Show your pictures to a librarian and receive a PRIZE\, see how many you can collect. Post your pics and tag the libraries #mlncrawl2024 \nWhat a way to spend a lazy summer day. All are welcome to participate – children\, families\, adults\, everyone! \nStart where you want\, end where you want – it’s a self-guided crawl \nCheck out the flier for all the details URL:https://baconfreelibrary.org/event/crawl2024/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/png:https://baconfreelibrary.org/wp-content/uploads/2024/08/librarycrawl-e1722958514908.png GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20240808 DTEND;VALUE=DATE:20240919 DTSTAMP:20260429T185120 CREATED:20240715T205546Z LAST-MODIFIED:20240808T214425Z UID:49334-1723075200-1726703999@baconfreelibrary.org SUMMARY:Mary Weafer Photography Exhibit DESCRIPTION: \nMary Weafer is a local photographer\, interior designer\, nature enthusiast\, and visual storyteller.  She focuses on the simplicity of nature’s textures and patterns to highlight the beauty found in everyday objects and spaces. Mary often travels throughout her home state to capture this beauty. “I want the viewer to see things they may have overlooked\,” she said. “You don’t have to travel far to find it.” \n  \n\n \n \n \n\n \n bookshelfbookspinesbullcemetarygraffitilakepaintpaintbrushespencilsseaweedstonestree \n\n \n \n \n \n  \nMary earned an associate’s degree in visual arts at Dean College and a bachelor’s of science in interior design at Wentworth Institute of Technology. She spends much of her time designing interior spaces for her clients. Mary lives in Medway\, MA  where she has raised her family for the last 20 years. She finds photography to be a creative outlet. \nTo learn more about Mary and her work:  \nwww.weaferphotography.com \n  URL:https://baconfreelibrary.org/event/weafer/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20240820T173000 DTEND;TZID=America/New_York:20240820T183000 DTSTAMP:20260429T185120 CREATED:20240329T205011Z LAST-MODIFIED:20240625T174459Z UID:48429-1724175000-1724178600@baconfreelibrary.org SUMMARY:Stacey Peasley Concert DESCRIPTION:Let’s celebrate Summer Reading with BFL favorite\, Stacey Peasley! With her creative lyrics\, fun rhythms\, and contagious energy\, Stacey will infuse pure joy into your evening. \nThis concert will be outdoors on the BFL lawn\, so bring a blanket or chairs to get comfy. Feel free to bring a picnic dinner as well. \nIf it rains\, the show will be indoors at the Morse Institute Library. URL:https://baconfreelibrary.org/event/stacey-peasley-concert-2024/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/jpeg:https://baconfreelibrary.org/wp-content/uploads/2021/05/SPband-e1754060040158.jpg GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20240914T113000 DTEND;TZID=America/New_York:20240914T123000 DTSTAMP:20260429T185120 CREATED:20240530T174322Z LAST-MODIFIED:20240909T182100Z UID:48988-1726313400-1726317000@baconfreelibrary.org SUMMARY:Instrument Petting Zoo DESCRIPTION:The Bacon Free Library is partnering with Bach to Rock in Wellesley to bring you this instrument petting zoo. B2R will bring a variety of musical instruments to the Bacon for 60 minutes of instrument exploration to give people of all ages a chance to learn about instruments and experience playing them. \nPlease stop by to try out an instrument\, or two\, that you’re curious about. No registration required. \n \n  URL:https://baconfreelibrary.org/event/instrumentpettingzoo-september/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/png:https://baconfreelibrary.org/wp-content/uploads/2024/01/instrument-petting-zoo-e1706030345580.png GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20240919 DTEND;VALUE=DATE:20241031 DTSTAMP:20260429T185120 CREATED:20240903T182649Z LAST-MODIFIED:20240919T184414Z UID:49801-1726704000-1730332799@baconfreelibrary.org SUMMARY:Quilts by Frances Caruso Daneault DESCRIPTION:The BFL  is thrilled to welcome back former Assistant Director and Children’s Librarian extraordinaire Fran Daneault to exhibit her spectacular collection of quilts. Along with raising her two sons in Natick and working at the Bacon\, Fran has also spent years perfecting her crafting skills. She applies the same energy\, creativity\, joy\, and humor to her artistic works that she brought to working with children and families at the Bacon\, where she frequently wore and gifted some of her handmade creations. \nA longtime resident of Natick\, Fran and her husband recently relocated to New Hampshire\, where Fran can be found walking on the beach\, volunteering in her local library\, and quilting up a storm. \nJoin us for an Art Reception on Tuesday\, October 8 from 5:00 to 6:30 pm! \n  \n\n \n \n \n\n \n My HouseGrownBambooHidden AlphabetFirst Trip \n\n \n \n \n \n  \n  \nFran’s work\, in her own words:\n \nI am a scrappy\, wonky\, modern\, art quilter who sometimes makes traditional quilts. \nI like learning in classes and workshops but have trouble sticking to a pattern. \nFor fabric\, I collect randomly spaced dots\, paisleys\, loudly busy prints and happy colors. I think\, perhaps wrongly\, that they all go together. \nI own way too much fabric but still feel the need to give orphaned fabrics a home. \nI hope you enjoy this collection of quilts. \n  URL:https://baconfreelibrary.org/event/franquilt/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20240928T113000 DTEND;TZID=America/New_York:20240928T123000 DTSTAMP:20260429T185121 CREATED:20240919T204753Z LAST-MODIFIED:20240919T204753Z UID:49849-1727523000-1727526600@baconfreelibrary.org SUMMARY:Mind Reader Gregg Dwyer DESCRIPTION:Gregg Dwyer has been involved in the arts for many years and is willing to give you a peek into the magical world which has been hidden from most.  Gregg’s goal is not to trick you\, but to help you see the vast potential that lies deep within your own mind. Gregg started as an escape artist and an illusionist on Doug Henning’s Broadway hit “The Magic Show.”\n \n  \nJoin us outdoors on the lawn for this amazing experience. No reservations necessary. \nIn case of rain\, this event will be held indoors with limited seating. \n  URL:https://baconfreelibrary.org/event/mindreader-2/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/webp:https://baconfreelibrary.org/wp-content/uploads/2024/07/gregdwyer-e1722964931710.webp GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20241008T170000 DTEND;TZID=America/New_York:20241008T183000 DTSTAMP:20260429T185121 CREATED:20240829T154553Z LAST-MODIFIED:20240910T173201Z UID:49775-1728406800-1728412200@baconfreelibrary.org SUMMARY:Art Reception - Quilts by Frances Caruso Daneault DESCRIPTION:  \nThe Bacon Free Library is thrilled to welcome back former Assistant Director and Children’s Librarian extraordinaire Fran Daneault to exhibit her spectacular collection of quilts. Along with raising her two sons in Natick and working at the Bacon\, Fran has also spent years perfecting her crafting skills. She applies the same energy\, creativity\, joy\, and humor to her artistic works that she brought in working with children and families at the Bacon\, where she frequently wore and gifted some of her handmade creations. \nA longtime resident of Natick\, Fran and her husband recently relocated to New Hampshire\, where Fran can be found walking on the beach\, volunteering in her local library\, and quilting up a storm. \n  \nFrom Fran: \n \n  \nI am a scrappy\, wonky\, modern\, art quilter who sometimes makes traditional quilts. \nI like learning in classes and workshops but have trouble sticking to a pattern. \nFor fabric\, I collect randomly spaced dots\, paisleys\, loudly busy prints and happy colors. I think\, perhaps wrongly\, that they all go together. \nI own way too much fabric but still feel the need to give orphaned fabrics a home. \nI hope you enjoy this collection of quilts. \n  URL:https://baconfreelibrary.org/event/franquilts/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/jpeg:https://baconfreelibrary.org/wp-content/uploads/2024/08/Grown-e1725906380138.jpg GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20241028 DTEND;VALUE=DATE:20241103 DTSTAMP:20260429T185121 CREATED:20241004T180525Z LAST-MODIFIED:20241007T181758Z UID:50060-1730073600-1730591999@baconfreelibrary.org SUMMARY:Celebrate Diwali - Take & Make Craft for All Ages DESCRIPTION:Stop by the Bacon Free Library during the week of October 28th and pick up your free Take & Make Diwali craft.  This easy to make craft is for all ages. \n  URL:https://baconfreelibrary.org/event/diwalicraft/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/jpeg:https://baconfreelibrary.org/wp-content/uploads/2024/10/20241004_132113-scaled-e1728325069617.jpg GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20241031 DTEND;VALUE=DATE:20241212 DTSTAMP:20260429T185121 CREATED:20241001T180457Z LAST-MODIFIED:20241203T195444Z UID:50039-1730332800-1733961599@baconfreelibrary.org SUMMARY:Nature Photography by Lia Vito DESCRIPTION:Lia Vito has brought the autumnal beauty of Acadia National Park to the walls of the BFL.  Come in to enjoy her photography featuring the rich golden hues of the Maine foliage along with up-close and personal peaks into wild birds in action.  \n  \n  \n  \n\n \n \n \n\n \n waterstonestairsowlfamilyheronfamilynestbirdfish3herons \n\n \n \n \n \n  \n  \nLia’s work\, in her own words:\nMy interest in action photography led me to a fascination with birds and other wildlife. Observing their behaviors and interactions has been educational as well as entertaining. \nWith a telephoto lens and lots of patience\, I have been able to capture special moments like the ones I have on exhibit here. These interactions between members of bird families warm my heart. \nI love visiting Acadia National Park. I have observed many beautiful natural scenes there and tried to do justice to them with my images. \n  URL:https://baconfreelibrary.org/event/liavito/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20241212 DTEND;VALUE=DATE:20250123 DTSTAMP:20260429T185121 CREATED:20241119T184237Z LAST-MODIFIED:20241216T164406Z UID:50398-1733961600-1737590399@baconfreelibrary.org SUMMARY:Carlos Santiago Art DESCRIPTION:Carlos Santiago’s still lifes walk a line between representational and abstract art\, with his primary source of inspiration being flowers and vases. In flowers\, he finds complicated patterns\, shapes\, and repetition; elements that show up in all of his paintings. \nPlease join us for a reception with Carlos on Tuesday\, December 17th.  You can also enjoy his paintings through January 22nd. \n  \n\n \n \n \n\n \n pinkanglespinkpurplemulticolor \n\n \n \n \n \n  \nCarlos has developed a signature technique that employs a sharp edge to create clean straight lines that extend the limits of his subjects\, adding drama and energy and a bold recognition to each painting. His use of shadow plays an important role in his work\, enhancing the contrast between the darkness and his vivid colors. \nCarlos doesn’t simply paint the still life subjects he sees\, but the dream-like gestures that he feels. Working with familiar compositions\, he hopes to create artwork that conveys not only the visual reality of his subjects\, but the vibrant extension of energy into their surroundings. \nCarlos Santiago is from Caguas\, Puerto Rico. He obtained his BFA in fine art from the Savannah College of Art and Design in Savannah\, Georgia. He subsequently worked for ten years as a design professional in the fashion industry in New York City. Now\, Carlos lives and works in Boston\, Ma. \n  \n  \n  \n  \n  URL:https://baconfreelibrary.org/event/csantiago/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20241217T173000 DTEND;TZID=America/New_York:20241217T183000 DTSTAMP:20260429T185121 CREATED:20241119T184609Z LAST-MODIFIED:20241210T141141Z UID:50406-1734456600-1734460200@baconfreelibrary.org SUMMARY:Art Opening Reception: Carlos Santiago DESCRIPTION:  \nJoin us for a reception for artist Carlo Santiago\, whose art will be featured at the BFL from December 12th – January 22nd.  This is your chance to meet the artist and to enjoy his art. This reception is free and open to the public. \n  \n  \n  URL:https://baconfreelibrary.org/event/csantiagoreception/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20241228T120000 DTEND;TZID=America/New_York:20241228T130000 DTSTAMP:20260429T185121 CREATED:20241025T172435Z LAST-MODIFIED:20241105T175928Z UID:50208-1735387200-1735390800@baconfreelibrary.org SUMMARY:Instrument Petting Zoo - December DESCRIPTION:The Bacon Free Library is partnering with Bach to Rock in Wellesley to bring you this instrument petting zoo. B2R will bring a variety of musical instruments to the Bacon for 60 minutes of instrument exploration to give people of all ages a chance to learn about instruments and experience playing them. \nPlease stop by to try out an instrument\, or two\, that you’re curious about. No registration required. \n \n  URL:https://baconfreelibrary.org/event/instrumentpettingzoo-december2024/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/png:https://baconfreelibrary.org/wp-content/uploads/2024/01/instrument-petting-zoo-e1706030345580.png GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20250210 DTEND;VALUE=DATE:20250215 DTSTAMP:20260429T185121 CREATED:20250117T184238Z LAST-MODIFIED:20250131T163553Z UID:51054-1739145600-1739577599@baconfreelibrary.org SUMMARY:Celebrate Valentine's Day - Take & Make Craft for Kids of All Ages DESCRIPTION:Stop by the Bacon Free Library during the week of February 10th and pick up your free Take & Make Valentine’s Day “Bee Mine” card craft. Pick up a craft and make a card for someone you love!!  \nThis easy to make craft is for kids of all ages. \n  URL:https://baconfreelibrary.org/event/valentinetakemake/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/png:https://baconfreelibrary.org/wp-content/uploads/2025/01/Bee-Mine.png GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;VALUE=DATE:20250521 DTEND;VALUE=DATE:20250701 DTSTAMP:20260429T185121 CREATED:20250522T144942Z LAST-MODIFIED:20250602T193002Z UID:52314-1747785600-1751327999@baconfreelibrary.org SUMMARY:Maps of Natick Art Exhibit DESCRIPTION:Stop by the BFL to view a selection of Natick Historical Society’s maps of Natick\, on display May 21st to June 30th.  These fascinating reproductions show the streets\, properties\, and bodies of water of Natick\, while some also display sketches of trees & buildings\, and in one case\, the handwritten names of property owners.  Among the historic gems are: \n\nan 1830 land survey of Bigelow Mills\nan 1887 map of Cochituate\nan 1887 rendering of South Natick including sketches of noteworthy buildings\na map of Felchville\, circa 1908\nan illustrated map reproduced in 1976 by Natick Five Cents Savings Bank for the Town of Natick Bicentennial Committee\n\n  \n\n \n \n \n\n \n IMG_7240Map2Map3Map1 \n\n \n \n \n \n  \n  \nMaps are available for viewing and purchase at the Natick Historical Society year round. Learn more at natickhistoricalsociety.org. \n \n  \n  \n  \n  \n  \n  URL:https://baconfreelibrary.org/event/natick-historical-maps/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20250524T110000 DTEND;TZID=America/New_York:20250524T120000 DTSTAMP:20260429T185121 CREATED:20250407T183525Z LAST-MODIFIED:20250407T183525Z UID:52063-1748084400-1748088000@baconfreelibrary.org SUMMARY:Instrument Petting Zoo - May DESCRIPTION:The Bacon Free Library is partnering with Bach to Rock in Wellesley to bring you this instrument petting zoo. B2R will bring a variety of musical instruments to the Bacon for 60 minutes of instrument exploration to give people of all ages a chance to learn about instruments and experience playing them. This event will be held outdoors at our picnic table. \nPlease stop by to try out an instrument\, or two\, that you’re curious about. No registration required. \n \n  URL:https://baconfreelibrary.org/event/instrumentpettingzoomay2025/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/png:https://baconfreelibrary.org/wp-content/uploads/2024/01/instrument-petting-zoo-e1706030345580.png GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20250701T000000 DTEND;TZID=America/New_York:20250827T170000 DTSTAMP:20260429T185121 CREATED:20250617T184537Z LAST-MODIFIED:20250617T185030Z UID:52528-1751328000-1756314000@baconfreelibrary.org SUMMARY:Joshua Mondshein Photography DESCRIPTION:The photography of Joshua Mondshein will transport you to beautiful and magical places.  Come to the BFL to view his work\, which will be on display from July 1st through August 27th.  You can also enjoy this collection of photography at The Center for Arts in Natick (TCAN) during the month of October.  \n  \n\n \n \n \n\n \n waterfall2waterleavesgrass2fieldcowestateboardwalk \n\n \n \n \n \n  \nJoshua Mondshein is a Natick resident whose passion for photography has led him to majestic landscapes throughout New England and across the world. Alluring sunsets and flowing waterfalls are two of his favorite subjects\, and Josh is often found exploring local trails\, parks and forests in search of the next striking photo opportunity.   \nJosh lives with his wife and Golden Retriever in the Walnut Hill neighborhood of Natick.  He loves playing tennis\, watching baseball\, and making the morning espresso; he currently works as an application developer in higher education.  \n  \n  \n  \n  \n  \n  \n  URL:https://baconfreelibrary.org/event/jmondshein/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20250805T173000 DTEND;TZID=America/New_York:20250805T183000 DTSTAMP:20260429T185121 CREATED:20250502T141854Z LAST-MODIFIED:20250502T141854Z UID:52207-1754415000-1754418600@baconfreelibrary.org SUMMARY:Stacey Peasley Concert DESCRIPTION:Join us for a fantastic family concert with BFL favorite\, Stacey Peasley! With her creative lyrics\, fun rhythms\, and contagious energy\, Stacey will infuse pure joy into your evening. \nThis concert will be outdoors on the BFL lawn\, so bring a blanket or chairs to get comfy. Feel free to bring a picnic dinner as well. \nIf it rains\, the show will be indoors at the Morse Institute Library. URL:https://baconfreelibrary.org/event/stacey-peasley-concert-2025/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/jpeg:https://baconfreelibrary.org/wp-content/uploads/2021/05/SPband-e1754060040158.jpg GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20250806T100000 DTEND;TZID=America/New_York:20250806T170000 DTSTAMP:20260429T185121 CREATED:20250804T182647Z LAST-MODIFIED:20250804T183102Z UID:52830-1754474400-1754499600@baconfreelibrary.org SUMMARY:Minuteman Library Crawl DESCRIPTION:We invite you to spend a day visiting local libraries — find out what is special about each one and what they have to offer you and your family. This is an event for all ages.  All you need is a love of libraries! \nThe challenge is to visit as many libraries are you can and take a picture of yourself with a designated item in each library — it’s a 21st century scavenger hunt!  Post your photos and tag them #mlncrawl2025.  Each library will have giveaways for visitors on the crawl.  \nParticipating libraries include: \n\nActon\nAshland\nBedford\nBrookline\nDover\nFramingham State University\nLincoln\nMaynard\nMillis\nNatick – Bacon Free Library\nNatick – Morse Institute\nNewton\nSherborn\nStow\nWaltham\nWatertown\nWinchester\nWoburn URL:https://baconfreelibrary.org/event/crawl25/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages ATTACH;FMTTYPE=image/png:https://baconfreelibrary.org/wp-content/uploads/2025/08/librarycrawl25.png GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20250828T093000 DTEND;TZID=America/New_York:20251028T173000 DTSTAMP:20260429T185121 CREATED:20250805T183639Z LAST-MODIFIED:20251016T143834Z UID:52837-1756373400-1761672600@baconfreelibrary.org SUMMARY:Robin Baratz Oil Paintings DESCRIPTION:Robin Baratz creates oil paintings that depict her instinctive connection to natural land and water and to the people. She motors and sails to reach and capture countrysides\, harbors\, and cityscapes of the United States\, Ireland\, Scotland\, Europe\, and Canada on her canvas.  But\, no matter what the actual locales\, the scenes have broad appeal\, reminding us of people and places we remember fondly.  \nCome to the BFL to view her work\, which will be on display from August 28th through October 28th.  You can also enjoy this collection of oil paintings at The Center for Arts in Natick (TCAN) during the month of November.  \n  \n\n \n \n \n\n \n Lobster ShackMorning Outside KillarneyNorth Sea IIVineyard Haven II \n\n \n \n \n \n  \nRobin studied privately for many years with Boston artist\, Joshua Graham.  She is a Fellow of the American Artists Professional League\, as well as an elected member of Audubon Artists and Catharine Lorillard Wolfe Art Club.  Robin’s work has appeared in numerous galleries and juried exhibitions in New York City (e.g.\, American Artists Professional League\, Audubon Artists\, Catharine Lorillard Wolfe Art Club) and Greater Boston (e.g.\, Willoughby Fine Art Gallery/Edgartown\, Martha’s Vineyard; The Crane Collection/Wellesley; The Wilson Gallery/Dennis\, Cape Cod;  Carney Gallery/Regis College\, Weston; The Horn Gallery/Babson College\, Wellesley;  Artsfirst Boston; The Ritz-Carlton/Boston; Shreve\, Crump\, and Low/Boston)\, as well as in many other exhibits in New England and in the southern and southwestern states.   \nRobin’s work has garnered many awards\, including the Crimi Award for a Creative Oil\, Audubon Artists (New York City); Judge’s Certificate of Merit\, Red River Valley Museum (Vernon\, TX)\, Third Place Oil/Acrylic Award\, Red River Valley Museum (Vernon\, TX); Allied Artists of America Award\, Connecticut Academy of Fine Arts (Avon\, CT); Guilia Palermo Award\, Audubon Artists (New York City); Honorable Mentions\, Havre de Grace Arts Commission (Havre de Grace\, MD) and National Society of Artists (Houston); Scholarship Award\, American Women Artists (Santa Fe); and the Cecilia Cardman Memorial Award\, Catharine Lorillard Wolfe Art Club (New York City).  Robin lives in Waltham.  \n  \n  \n  \n  \n  \n  \n  \n  URL:https://baconfreelibrary.org/event/rbaratz/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20250906T110000 DTEND;TZID=America/New_York:20250906T120000 DTSTAMP:20260429T185121 CREATED:20250610T165127Z LAST-MODIFIED:20250610T165127Z UID:52427-1757156400-1757160000@baconfreelibrary.org SUMMARY:Instrument Petting Zoo - September DESCRIPTION:The Bacon Free Library is once again partnering with Bach to Rock in Wellesley to bring you an instrument petting zoo. B2R will bring a variety of musical instruments to the Bacon for 60 minutes of instrument exploration to give people of all ages a chance to learn about instruments and experience playing them. This event will be held outdoors at our picnic table. \nPlease stop by to try out an instrument\, or two\, that you’re curious about. No registration required. \n \n  URL:https://baconfreelibrary.org/event/instrumentpettingzoosept2025/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages,Featured ATTACH;FMTTYPE=image/png:https://baconfreelibrary.org/wp-content/uploads/2024/01/instrument-petting-zoo-e1706030345580.png GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT BEGIN:VEVENT DTSTART;TZID=America/New_York:20251105T093000 DTEND;TZID=America/New_York:20260129T173000 DTSTAMP:20260429T185121 CREATED:20251027T153528Z LAST-MODIFIED:20251104T155020Z UID:53382-1762335000-1769707800@baconfreelibrary.org SUMMARY:Tom Doran: Ease Your Eyes DESCRIPTION:Driven by a desire to reconcile structure with chance\, Tom Doran creates unique digital compositions that layer photography and previous artworks. Informed by years of jazz improvisation and the tactile nature of paper collage\, his process embraces spontaneity and a pursuit of balance between order and disorder. Tom values fundamental artistic principles\, yet intentionally introduces ambiguity to ignite curiosity and encourage viewers to venture beyond familiar perspectives. While often abstract\, his pieces resonate with an underlying “soul” and subtly reference the organic forms and energies of nature. Ultimately\, Tom aims to craft works that prompt personal interpretation and reveal unseen possibilities\, echoing the belief that compelling art poses questions and offers new ways of seeing. \nAccording to Tom: “I use color and texture to challenge but also soothe you. While I don’t require beauty to be an element of my work\, I value beauty hence Ease Your Eyes.” \nCome to the BFL to view Tom’s work\, which will be on display from November 5th through January 28th.  You can also enjoy his work at The Center for Arts in Natick (TCAN) in the Spring of 2026.  \n  \n\n \n \n \n\n \n Doran_silverDoran_redDoran_green \n\n \n \n \n \n  \n  \nTom’s art career didn’t actually begin with art. Instead it started with music. First\, rock\, in the soul\, funk\, and r&b area\, then on to jazz. The jazz aesthetic provided the basis for his art: study and be well prepared so that when it’s time to improvise- make the leap! \nTwenty years ago he began improvising with collage and paint. Now his art is in the digital domain but he uses the same techniques\, now called “pixel collages”: Use original images\, find things to work together\, keep it fresh\, improvise. Tom is fascinated by nature\, geometry\, and strong colors so all of that comes out in his pictures\, which he describes as a collision of nature and the modern world; at times ironic\, funny\, eye candy-like\, digital\, abstract\, and hopefully\, fun. \nTom is a proficient jazz bassist and singer who is mostly self taught\, he is mainly a self-taught artist as well.  His influences include Picasso\, Matisse\, Joseph Stella\, Juan Gris\, Georgia O’Keefe\, Lee Krazner\, Arthur Dove\, Gerhard Richter\, Romare Beardon\, Sam Gilliam\, and Mark Bradford. \nTom says: “Please judge me by my work.” \n  URL:https://baconfreelibrary.org/event/tdoran/ LOCATION:Bacon Free Library\, 58 Eliot Street\, Natick\, MA\, 01760\, United States CATEGORIES:All Ages GEO:42.285064;-71.346109 X-APPLE-STRUCTURED-LOCATION;VALUE=URI;X-ADDRESS=Bacon Free Library 58 Eliot Street Natick MA 01760 United States;X-APPLE-RADIUS=500;X-TITLE=58 Eliot Street:geo:-71.346109,42.285064 END:VEVENT END:VCALENDAR